PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C012107P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 340aa    MW: 38607.3 Da    PI: 6.5868
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C012107P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.94.7e-22953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr en+  rq t+skR+ngi+KKA+ELS+LCd+++ +++fs+tgk
  MELO3C012107P1  9 KRLENTNGRQSTYSKRKNGIMKKAKELSILCDIDIILLMFSPTGK 53
                    689****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-30160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.404153IPR002100Transcription factor, MADS-box
CDDcd002661.70E-27283No hitNo description
SuperFamilySSF554553.27E-25294IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-17323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRVKLKIKR LENTNGRQST YSKRKNGIMK KAKELSILCD IDIILLMFSP TGKPNLSCEK  60
RSFEEVIARF AQQTPQERAK RKMESLDSLR KTFKKLDHDV NIDDFLGTSS QTIEDLAGQA  120
KLLRAQLSEV HQRLSYWRNP DKINNVDHLS QMEDSLRETL NQVGLHKENL QKHPPVPLEF  180
TNQDGMHLPF DMSVEQQLQQ LQHFSWIPSD SQNIVLHDDP NFVLHRDAEC SASSSFTSYP  240
GYFGTGRSPD ISNSGQENVV LPELSRTEPL RPQLGGQNSY MSYNVNFYND PTFQPAAEMN  300
LPVNPVDYHV NGNFDTTQHN WASSSGPCAV SLLDDRLFP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818960.0LN681896.1 Cucumis melo genomic scaffold, anchoredscaffold00016.
GenBankLN7132640.0LN713264.1 Cucumis melo genomic chromosome, chr_10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008446372.10.0PREDICTED: MADS-box transcription factor 22
SwissprotQ1PFA41e-112AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A0A0KU260.0A0A0A0KU26_CUCSA; Uncharacterized protein
STRINGPOPTR_0008s08780.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-102AGAMOUS-like 30